DPCstruct | MC2722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 243 ± 26 aa |
| Standard deviation of domain lengths | 26.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 80.21 |
| Assigned Pfam label(s) | CL0220- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0GDE6 | 104-370 | SVNSNGTACELILEPEYFMDMLIEKYFNTTTNRIYADGIDKLIDSLGTATTVAADDKSCSGNGHWDNTECHCDSGYTLSEDGRQCTA… |
| A0A7M7PFG3 | 240-486 | EPILPSTTDFTEAIFDTFATLGVIPEEEFAHMLIDLGIGGEDGHDHEHARRRRDVIATRSKGRSIEKRATVLADDHDHANHSHSHVA… |
| T1HNE0 | 1-254 | None |
| A0A1I8HEM3 | 241-486 | None |
| A0A674GGH2 | 6-262 | None |
| A0A498LJE1 | 1-228 | None |
| A0A3P8S8A8 | 227-465 | None |
| A0A2K5NDM6 | 8-243 | None |
| A0A6P8IAH9 | 14-263 | None |
| A0A1S3IGN3 | 2-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.