DPCstruct | MC27209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 316 ± 49 aa |
| Standard deviation of domain lengths | 49.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3RWV4 | 4-249 | VQHFANLLNSLLPRHFEAVKDPSLCLRDCIQRYMDLVEDPSGLASTFVGAEVFDAHVTCCLTLLSNMATSESLAAEAVAGNGKPLFS… |
| A0A0S7IFM2 | 1-298 | MTSEILNAMNILTQPLGEASAQPSQQEALHAALGANRSVLLERLLSDGSLQRAARLRDETKGEADWYSSETDDVTWSFVQECLLLLL… |
| A0A183LYM3 | 35-331 | None |
| A0A090XDZ8 | 15-377 | None |
| A0A670YYE7 | 20-386 | None |
| A0A0B7FTF1 | 10-406 | None |
| A0A167CHW3 | 30-351 | None |
| Q54Y11 | 104-494 | None |
| A0A672PGK3 | 1-343 | None |
| A0A368F4I7 | 11-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.