DPCstruct | MC27205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 63.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Q5Y9 | 70-145 | MVIDKVPFDKYELEPSPLTQFILERKSPHTCWQVFVCNSAKYSDLGQPCGYLKASTALNCVNLFVMPYNYPVLLPL |
| A0A0S7HUD6 | 1-105 | MVIDKVPFDKYELEPSPLTQYILERKSPHTCWQVFVSNSAKYSDLGQPFGYLKASTALNCVNLFVMPYNYPVVLPLLGKTRLHALPS… |
| A0A6A4WFE2 | 311-400 | None |
| A0A504ZAK5 | 286-366 | None |
| A0A819NDB7 | 70-161 | None |
| A0A820GJN6 | 49-140 | None |
| A0A0K8S9G0 | 349-431 | None |
| A0A0N4T293 | 158-237 | None |
| A0A226N442 | 77-162 | None |
| L7M6H7 | 228-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.