DPCstruct | MC27204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 152 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5KVR8 | 19-165 | QKCIATLALFCCSAVLMVLIFSSVDIWGDSEDGITEENCSRDCRIVLAENIPDDLSLHVDGRHHIPLSVGFQSLLEQAKLSVEVVSS… |
| A0A0S7HSJ2 | 1-178 | MKLDVTYNQMVDPERRRQEFSRRAQLFARCQIALAAVACVLLAAMALYNILSARSAGSVKSAGSTLHHPASISSRFQETVESCSDPC… |
| A0A674GZ20 | 92-223 | None |
| A0A0B1TWG6 | 1-140 | None |
| F4PP14 | 402-551 | None |
| A0A667I3R6 | 238-406 | None |
| A0A674HAU8 | 1-153 | None |
| A0A6P7WIR9 | 144-305 | None |
| A0A7R8VU85 | 73-226 | None |
| A0A6A4X0M8 | 20-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.