DPCstruct | MC27203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165NIS7 | 141-325 | EPIHQVLSYNGGQELTRYDRALVRSILAVDDSTARSIATWCARAAFDFAGLSDRPWVRPVLDALAAGQKLPSPFASYAEIGTAFAQL… |
| A4FQH3 | 374-532 | AESWAGRAPSERLRQAGGHAWAMAQLDRDLVDEIADLDADAQRSLARWAVRRAYELAGLDGIDWIAPALAALEQGRELPPPFDDKLG… |
| A0A848KHQ2 | 22-189 | None |
| A0A3N7B6X9 | 150-321 | None |
| A0A316TF85 | 393-556 | None |
| A0A401Z4R1 | 204-363 | None |
| A0A260T841 | 94-259 | None |
| A0A1S6RC29 | 2-143 | None |
| A0A1I2Y104 | 211-402 | None |
| A0A370FSF5 | 5-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.