DPCstruct | MC27202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K1JSG3 | 1-72 | MFAPAPEPPTRLGYYRKLASRAGIHVSPLCLGGMSIGDKWDKFGMGSMDKEASFRLLDAYFDAGGNFIDTAN |
| V2YLM6 | 63-136 | MSAFAPVPPPPTKLGVYLTLAPRAGFHVSPLCFGAMSIGDKWNSFMGSMDKESSFKLLDVYLEMGDNFIDTANK |
| A0A364N9W8 | 3-75 | None |
| A0A4Q6EA79 | 40-111 | None |
| A0A0G4NEC0 | 4-97 | None |
| A0A094JEZ7 | 307-381 | None |
| A0A4U0W1W5 | 1-67 | None |
| A0A7G5K3U4 | 310-382 | None |
| V2W5B5 | 3-73 | None |
| A0A4Y9ZBR6 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.