DPCstruct | MC2720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7PDW7 | 9-94 | DDLLSKLAEDIETGEQMEALGRTLGFKVADINRYTETNRIEGRVTCKGTRDMLFDWRQTVEPCDQHIRLKQALIDAELVMLADTYL |
| A0A7M7PB10 | 166-270 | EPSESSERKEELSATPVRLDDILLYDIAEEIETDEHLERLMHTLEVTQGSQSRYHEINRLEGRLTAKGTRQMLMDWRARTAVVEQRD… |
| A0A7M7GG66 | 119-235 | None |
| A0A7M7NDK7 | 5-108 | None |
| A0A7M7NDC8 | 533-659 | None |
| A0A7M7NCN7 | 1-101 | None |
| A0A7M7NCK4 | 1093-1216 | None |
| A0A7M7NAP0 | 246-362 | None |
| A0A7M7NAM0 | 311-418 | None |
| A0A7M7N9Y7 | 134-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.