DPCstruct | MC27193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 669 |
|---|---|
| Mean domain length (aa) | 153 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 82.91 |
| Assigned Pfam label(s) | PF19643- PF07715- CL0193- CL0287- CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837Q3B9 | 2-144 | TSTASDKILSGDTLRQKAVNLGDALDGVPGIHASQYGGGASAPVIRGQTGRRIKVLNHHGETGDMADFSPDHAIMVDTALSQQVEIL… |
| A0A7H0LKW9 | 8-167 | PAPDDSDIIVIGRASHRIGAARSASEGVIGGEDLRIRPLLRTSELAEAVPGLIAVQHSGGGKAAQYLIRGYNLDHGTDFSIAIDTMP… |
| A0A1G1TEE3 | 119-276 | None |
| A0A1Z3HGV2 | 100-291 | None |
| A0A532E0I7 | 123-256 | None |
| A0A812NI07 | 16-179 | None |
| A0A812NJL2 | 2-141 | None |
| A0A3A5G850 | 103-375 | None |
| A0A7W1SQ82 | 56-184 | None |
| A0A426H6I4 | 122-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.