DPCstruct | MC27192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0LHW9 | 1-81 | MAGISNERREWHRLATENAKRTLKVGDRITFTSCPGTKRWAIVTGWDGVWICSKTRNDIAAATICTLNGQPVSFARGPRPD |
| A0A7W6CET8 | 99-164 | SQLRNHLADVALRPLLKPGDRIRATKAECCAHEANFTYSHFYGGWIISNGGASIAPGSVYSINGKV |
| A0A2W5PFP4 | 3-96 | None |
| A0A2K2G485 | 2-79 | None |
| A0A357RTA6 | 25-96 | None |
| A0A1Z3U566 | 1-81 | None |
| G0J3A2 | 31-100 | None |
| A0A1X9YFW4 | 4-89 | None |
| A0A506UIP8 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.