DPCstruct | MC27191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 268 ± 38 aa |
| Standard deviation of domain lengths | 38.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512UD22 | 6-240 | DHYYTLASEVPQERIQAATKLLSELGKANVTEEWDYALNRLIKGLTTSRQSARFGFSMALTELVRELVTKSDYDLSVSSFLDKVIAA… |
| A0A6C1MB97 | 15-299 | VNVDVKLVEIYEDLSNEQNEIRLKAAHDLLSRFTPDQNAPNEQIEKVLKRLFRGLCSSRKAARIGFSIALTELLSQVFSGSNGRNSE… |
| A0A2S5BC53 | 1-345 | None |
| A0A5B7FGR9 | 8-293 | None |
| A0A034VLD7 | 48-358 | None |
| A0A654HTT5 | 12-274 | None |
| K3WSV6 | 62-363 | None |
| A0A437CNA5 | 16-289 | None |
| R1C276 | 7-236 | None |
| A0A0N4UXX4 | 3-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.