DPCstruct | MC27188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 18.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C1LXF1 | 7-131 | APLEKKGRAKADKRITLIRYFLYHPLTPRPLRFSRDRYLRHWTIHRAWNLYQAKRRAARDLELERMYTSMRNACEELRTGVGDGGYL… |
| A0A2C5YCP4 | 17-145 | KPKGGAQSEFWAKVRVLRQDMFINPPPALRMGRLRHLRHWTIHRAWQLYRRHVKEAFVTERQRIYAGMYWACEELRRTQWPANRSEG… |
| A0A261Y251 | 1-138 | None |
| A0A6A6NPG7 | 3-142 | None |
| A0A6A6Z053 | 45-182 | None |
| T5AEL3 | 607-783 | None |
| A0A0B1PDE7 | 1-107 | None |
| A0A1E3NXQ9 | 3-145 | None |
| A0A1V6URG2 | 101-238 | None |
| A0A1L9SWB5 | 30-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.