DPCstruct | MC27185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511C0P5 | 27-108 | TLHIYGQQMWHDNAYIVGNRAALQRLQDQITQALQYGEKKDVFFPNDGEGYDLYVACVDDQFNWENLEAPYHDTEIFEKRKQ |
| A0A3D3KQN8 | 1-86 | MDNILHIYGQHCWHNEAFIVGDKEALQRLADAINQAISVGTGRCQSGVNDGEGFDVYIRYIDDQQTLDKLALPYTSDAAKEKDKSA |
| A0A847YRT9 | 11-98 | None |
| A0A268RX84 | 6-88 | None |
| Q5FN32 | 6-96 | None |
| A0A084GJL5 | 3-95 | None |
| A0A8B0JA44 | 6-99 | None |
| A0A1G6UHT7 | 116-199 | None |
| A0A7U0R5H4 | 9-97 | None |
| A0A7X4HCX2 | 63-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.