DPCstruct | MC27183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3TK33 | 52-173 | TWTNQAQSGNFTRNNCPPNYTGSSVTYNVAANTYNSTISLADANQKAIDDVNANGQSYANTNGTCTSNCNVGNCTGDNKKCINGVCE… |
| A0A0J0YC85 | 110-209 | SFKNVAKSGSFTKNNCGVGGTGSVVIYTVAAGKYTASTQAAADALAQDDVNKNGQAYANAGTNGSCTYKSTKSSYFVRNNCDTAGGM… |
| A0A1V9FZ72 | 2-105 | None |
| A0A4Q1EXQ9 | 70-171 | None |
| A0A2T7BCR8 | 89-208 | None |
| G8TA76 | 838-963 | None |
| A0A1I6NSJ1 | 214-331 | None |
| A0A0X7BCB4 | 412-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.