DPCstruct | MC2718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444ISG5 | 110-223 | SKSLDIIKQFGGSTMGDTYNIHGGQVGAIGKSAAATGNTFQQIVSDLSRLHDEMQNKAATPEQQAATQDIAKAKQAAEQGDKPTMQQ… |
| A0A317M2E8 | 5-114 | DEVMGDKITINNSAIGAVGSGAVNYGNVTSSPENYDYNLMREEIITLKNAIQSQPQSDAQILALSTIIQAEEGASTQNGTIMISALR… |
| A0A6H1NA13 | 47-171 | None |
| A0A1Y6D748 | 140-266 | None |
| A0A4R2IS26 | 376-524 | None |
| A0A7Y4U7V4 | 108-239 | None |
| A0A329DRN9 | 572-717 | None |
| A0A7W4QBT4 | 309-451 | None |
| A0A1Z5SGD2 | 4-133 | None |
| A0A7Y4VVK6 | 210-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.