DPCstruct | MC27173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 180 |
|---|---|
| Mean domain length (aa) | 295 ± 64 aa |
| Standard deviation of domain lengths | 63.55 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0186- PF08486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4V4P2 | 90-287 | KCIDGKIRLTRIKDYLYRLAEEPDDWPMEGLKTLMVAARSYLWYKLDRYGYMPGGQYYIHTINPKKRPRTVAAVKATQHLIATYNKQ… |
| A0A6G1X3T5 | 35-393 | EGVKYKLIVKQGELYIKDSSGRKKIPGSFTLIPESYDQNLIYINDRPYQGAMDFTIENEKYIRPINQLHLEDYLKGVVPFEVFSEWD… |
| A0A7W0NS14 | 35-404 | None |
| A0A7V9C7U2 | 75-422 | None |
| A0A3S0BCQ3 | 56-337 | None |
| A0A1T4PGK0 | 520-938 | None |
| R5UYW5 | 121-317 | None |
| R5LRU9 | 95-348 | None |
| A0A7K2AI65 | 296-571 | None |
| A0A3M1GLG1 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.