DPCstruct | MC27171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 240 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E3WL04 | 5-230 | LSKAIGTAVLFTTAANAAVAGTFSSQYSRFVRDFQDVADKISDFEVQAQNVGKAVQNIGQRLINDPSSAEVLLEEVIADGLLMLKEE… |
| A0A4Q2DG56 | 11-238 | FLPPSPIEAIISSAKENGEAVAASVLKDLANQYPVITDQVQQFQEHFNKIIEDAKDLKRELVDNNIDPTVVHDHLTREAANIIETLR… |
| A0A166D2Z0 | 33-248 | None |
| A0A137R0J0 | 5-182 | None |
| J4G7P2 | 57-331 | None |
| J4GPK1 | 11-313 | None |
| A0A4S4LXV7 | 38-274 | None |
| A0A0D7BDE1 | 20-258 | None |
| A0A1C7MEZ6 | 332-542 | None |
| A0A4S8L7K1 | 185-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.