DPCstruct | MC27170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 194 ± 45 aa |
| Standard deviation of domain lengths | 44.99 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20415 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3K9R2 | 7-156 | LQYLPLSQPEINYDISLPTMAHNLDFLKLAQSATSPPLHQLTIVCPEFLPWHIVVNAPPGAFVSVRDVLDTIYRELRHPVTRAEYES… |
| A0A0D0BC12 | 17-206 | PETAQIPAMPWPQTVYERPQIAPWIAQNPFQPTMPMLQWDVRQNPITARLTTGAHVSTNLAHVLSSPITNIPVGIIEIAIPACPMAY… |
| A0A0D0CQV7 | 91-272 | None |
| A0A165TWE6 | 10-190 | None |
| A0A4U0VYQ1 | 62-211 | None |
| A0A6A6ANF0 | 25-145 | None |
| S7PVQ9 | 180-428 | None |
| A0A2H3D9L6 | 9-134 | None |
| A0A4Q4YVK0 | 19-151 | None |
| A0A0A9PGU3 | 4-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.