DPCstruct | MC27168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 171 ± 36 aa |
| Standard deviation of domain lengths | 36.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3CQB4 | 2-145 | QATTVIQNVYVGESHLQLQEQEERKKRPRKRTRIMGDGMAKLVTGDEFTKHVEEHEQEGIDEQEAKDVRAELMERYKTAIKEWEERE… |
| A0A0D0AVE2 | 16-155 | MQSTAVLQEMYCKILSSQLAAQEEKKLARKWEKLVGDGLPRLLTGDEFYHSVVDHNNVADAELAARESSQQERDERVSLMKAWKEED… |
| A0A067PU11 | 139-305 | None |
| A0A0D0D368 | 7-181 | None |
| A0A0D0CRF5 | 95-282 | None |
| A0A137R035 | 2-144 | None |
| A0A5C2TDV7 | 96-230 | None |
| A0A0D0EB49 | 137-315 | None |
| A0A1Q3E4F6 | 141-378 | None |
| A0A409X9L3 | 8-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.