DPCstruct | MC27165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822G191 | 106-184 | YNGDWNIVNFDIIKANSNSDNSENTMLYQAYQQLHTNAHITFRRSNEQLWHAQYIGMHSTDHGGAYRDSLTRICSDICS |
| A0A819UZW3 | 1-89 | AALTKTAVNLESSEINIKFDIVKASIAEHPEDNMFYEAYKQLKSDASQIFRRTEDEQVWKATYVGMFSIDQGGSYRDSITRICADLC… |
| A0A821BVB8 | 1-88 | None |
| A0A817GI55 | 113-202 | None |
| A0A817X6K6 | 227-324 | None |
| A0A821TT85 | 1-88 | None |
| A0A821CKG0 | 200-297 | None |
| A0A821EY01 | 57-140 | None |
| A0A814CI26 | 184-277 | None |
| A0A818TMU5 | 251-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.