DPCstruct | MC27164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 63.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183SEX2 | 1-112 | MFRIGGLSRNSECSGCSERGHRQGDVVKTPSGVRKKFNGKQWRRLCSRDGCTKESQRRGFCSRHLSMKGKEIRAFSYAATAAAANMF… |
| A0A821G8U5 | 58-172 | STIGSNFSLNNNNNNNNSNDIPTTIYNQITYRKGDVMTSTQSQIRKKFNGKQWRRLCSKDGCPRESQRRGLCSRHLSQKGRQEHNAQ… |
| A0A0R3T6X4 | 1-129 | None |
| A0A5K4EPY4 | 84-216 | None |
| A0A182H2J8 | 668-760 | None |
| Q4SWJ3 | 541-658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.