DPCstruct | MC27163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 285 ± 34 aa |
| Standard deviation of domain lengths | 33.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3HPF7 | 3-246 | LGAVKRILRAEKAVACSGAAQARIKILASLVTQFDSGLKAEVLSFILEDVRGRLDLAFAWLYQEYNAYLAAGASGTLDKYEDCLIRL… |
| A0A817EVI8 | 5-267 | IGQEQVTSNITNVRNDDRLFVTSSAFDSKTHLASTKETLSICTDLIKISSIQQKKTKSFKLSNVIKSLEYDEMQRMSLDSFHRMLHA… |
| A0A0J9U7I8 | 213-512 | None |
| A0A1V2LT44 | 169-429 | None |
| A0A080WEW6 | 1-278 | None |
| A0A7S3TU93 | 1-246 | None |
| A0A446KKP3 | 543-863 | None |
| A0A7S3TT19 | 1-236 | None |
| A0A4U0WM11 | 172-453 | None |
| A0A6V7VB04 | 64-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.