DPCstruct | MC27157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 267 ± 44 aa |
| Standard deviation of domain lengths | 43.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8RGB4 | 1-209 | MTYMLAFPMNGHEIHFGFRDTDLIVQARVRGTILEYIPPAIFGDLQNFDLPGPLIANCVHWLDLNSGIMEVRRRPDIWKSKSSHWCV… |
| A0A817E008 | 24-317 | RYISIDCIKGTFLFDGMTIGLLPEKITSNELFVRVFGEHIFEVQAAKSSNTDITKHSYHGDRRIQYEFHFNDQTECLTITERHIQTN… |
| A0A820U798 | 302-614 | None |
| A0A833SSU0 | 473-758 | None |
| A0A1J8PVJ7 | 115-416 | None |
| A0A1J8Q2Q5 | 159-459 | None |
| A0A117NSF3 | 235-551 | None |
| A0A5N6E6D4 | 419-701 | None |
| F4PXL9 | 45-233 | None |
| C4JQK6 | 244-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.