DPCstruct | MC27154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 245 ± 70 aa |
| Standard deviation of domain lengths | 70.02 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 95.37 |
| Assigned Pfam label(s) | CL0123- PF02595- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5R6K7 | 27-282 | DRLLPLSDGGDGFLECLHHALGGAWRSVEAADPFGRRRAVPVLELPDGTVALECARIVGLAGLDRLDPRTARSLGLAEALAQVIKAP… |
| A0A2V1K2S9 | 22-304 | LGEAGERHFAYRAGTALLLDYTQILYGIPQEGASQSSHIVGRDLAWALREGISEVHIVLPIPGCVSDLGMGILEELGGLDAAREALA… |
| A0A251XU55 | 57-382 | None |
| A0A7V9HAT1 | 9-265 | None |
| A0A7X9YIA2 | 225-579 | None |
| A0A7V3ADP1 | 331-665 | None |
| A0A348XDU1 | 9-196 | None |
| A0A3P1WGK2 | 111-301 | None |
| A0A838K070 | 3-172 | None |
| A0A380FMT2 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.