DPCstruct | MC27153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6PN79 | 98-212 | EIHSWNNQERLEKKQDEERRQTLSIQFPEFLNQEEFNRIIHEEANQIIRIKKIEINQALINFEVYSISRISTWFFTLDYNDYGSLTG… |
| A0A2V1K014 | 1-139 | MAWYETLAAGAGAALLGLVFKKVREEQAETRRRLESPLCFDDGITQEEFSRIVHKAVQRAPRIIKVSIEGMVVTFTVESNTGLSVWN… |
| A0A1I1K4Z1 | 1-133 | None |
| A0A412F9I9 | 9-116 | None |
| E6LHF0 | 18-124 | None |
| A0A3D0IH81 | 1-141 | None |
| A0A3D4W1S4 | 12-153 | None |
| A0A316TPY5 | 99-247 | None |
| A5ZWY6 | 17-157 | None |
| D0UZB3 | 29-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.