DPCstruct | MC27150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 54 ± 2 aa |
| Standard deviation of domain lengths | 2.12 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8YAC3 | 3-55 | YFYDCEFIEDGRTIDLVSIGVAAEDGREFYAVSTEFDPTKAGKWVRANVLPKL |
| A0A5C7FV43 | 1-51 | MSQHLFVDTEFTGFKDPKLISIGVVAQTGEEFYAEVEHSADECSDFVRATF |
| A0A1J5RWX5 | 2-56 | None |
| A0A7X2IDC3 | 23-76 | None |
| A0A5E5BP82 | 25-77 | None |
| A0A0W0PSP1 | 1-50 | None |
| J3B6C2 | 1-54 | None |
| A0A6S7D711 | 1-55 | None |
| Q46N11 | 34-90 | None |
| A0A1W9TZV0 | 4-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.