DPCstruct | MC27147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6GNJ8 | 12-170 | MLTACASAPRLAMPTQIAAPAPIVGNTGKYMSPYTEDGTVAPWVEKGRNASAGASIGGFVGAQAGQKLAENIPFVGGFLGQAIGESA… |
| A0A556QJM1 | 22-204 | MANTAADIARAETVMRKVLLVSGQYEGKNLVLTAPAPVADKKGKYFAPYDGNGELTPWAKKAVEANLGSIAGDKAAGGAMTALGGAI… |
| A0A1G0LPM7 | 9-182 | None |
| A0A6M5ZCT3 | 109-266 | None |
| A0A1E3CEC3 | 136-286 | None |
| A0A518BFT1 | 16-172 | None |
| G2ISI7 | 28-215 | None |
| A0A2T1KJW9 | 384-522 | None |
| A0A1M2UZP0 | 276-418 | None |
| A0A142FVZ4 | 184-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.