DPCstruct | MC27143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 236 ± 62 aa |
| Standard deviation of domain lengths | 61.71 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0062- PF04749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0T9L6 | 15-145 | AGIMVPSLIFIITVTVVSSFFPTQTGAILNVVKNWIFVNLNWIYVWSVTIFVIFLLVLTFSKYGAIRLGDDDEKPEHSFFSWISMLF… |
| L1JML1 | 10-243 | AFRLPPLDLALNPVVAFFAFGIIWAFIVACIAVPVEFSGQIWWWKRQILSTFLWLYYLCENVWVIFIIWLCYSRWGTFTLGESQRDT… |
| A0A0Q8NI21 | 10-192 | None |
| A0A411YB42 | 28-168 | None |
| A0A2M9AJI4 | 2-295 | None |
| A0A1A0J9S5 | 2-218 | None |
| A0A7M5UUX0 | 61-359 | None |
| A0A4R6DWJ2 | 2-261 | None |
| A0A6N3UDA7 | 43-219 | None |
| A0A6B8TM20 | 4-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.