DPCstruct | MC27142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1JF88 | 7-127 | EQLYLDCCAAYNVDAESLLSDEDYEKLKTDLTFEGSQVILMSREEIKFMVAANRYNKGKPIMSDEEFDTLRKKLKNKGSLAVKHEAA… |
| A0A0G4EJP6 | 238-368 | KLTTAEKERVFLDALQSYYLSGWQALTDGDFDLLKQDLAWEGSDVIFLTRNETLFLNAMSAYMKGQPIVTDEEFDTLKAELRNQGSR… |
| A0A2K1KVB5 | 1-114 | None |
| A0A453MKS3 | 1-161 | None |
| A0A3L6TF69 | 1-120 | None |
| A0A7S0N9T8 | 2-142 | None |
| A0A0E0QLG2 | 1-124 | None |
| A0A453MKW2 | 18-147 | None |
| M1AXK5 | 1-101 | None |
| A0A446RC49 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.