DPCstruct | MC27141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 290 ± 53 aa |
| Standard deviation of domain lengths | 53.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 98.93 |
| Assigned Pfam label(s) | CL0306- PF19324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653DE58 | 40-345 | IYKTEAKKIRVYAVNRYWEYLKNYDKVLEKRFPEAMKVYRVFVDGVKEFMKDTKEYFRVVVILNKSNFDFSKLLRREIELYHQMPKD… |
| L1JBY8 | 6-298 | DEPKPSWLATKWAHVKHEAYHYWLGTKLLGKEIGICVGILKQILRGEELSRREYRQLRTTSTDLLKMVPFAIIVLVPFMELALPVIL… |
| A0A7R9YFW8 | 26-365 | None |
| A0A179I784 | 52-250 | None |
| F4PJ15 | 100-453 | None |
| A0A821EPR6 | 2-201 | None |
| A0A1Y2HEA9 | 13-260 | None |
| A0A2S4KML7 | 347-652 | None |
| A0A2H3CAH1 | 29-305 | None |
| A0A0M3IPB5 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.