DPCstruct | MC2714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0SB19 | 178-271 | THDPVKEQMLLFLTPEGYERRTLVDEYGEEVDYRDYVAWTRNDKLFIITKHDAFHPQPIDITSAPNGMNLLFEYDLVPVVTMEQGNK… |
| A0A3M4SPA0 | 5-87 | VLQGFLDGVPPKEAKQLKTTGNVPDTTVWQMGDDLYIRTRADIRDEFESTLSSADGTHLWKLPVTPYVSFSVMGHTAALNVAL |
| A0A149SKX8 | 60-156 | None |
| G2JAR9 | 43-145 | None |
| A0A847JHB0 | 1-98 | None |
| A0A3M3Q311 | 99-196 | None |
| A0A077ZKE5 | 434-536 | None |
| A0A0F9V9Q4 | 255-340 | None |
| A0A2E2TYZ8 | 215-296 | None |
| A0A2T4MX42 | 229-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.