DPCstruct | MC27133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 223 ± 46 aa |
| Standard deviation of domain lengths | 45.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7Z1F1 | 123-384 | PTPLAGFLEMLAILLIPAALCHTFGKMVKDARQGWAVLAAMTVIFVGLAALCIAGEQAGNPRLAALGVDQRAGEMSAGGNLEGKETR… |
| A0A150MSP3 | 34-249 | LWLKLSTIQLIILFYLAAVAVSTVLLWLPIVHQPGVELHWIDALFTAASAISVTGLTVVSIPETFNTFGIVLLIVMMQVGGVGLMML… |
| A0A839RY07 | 33-195 | None |
| A0A7J9L083 | 11-345 | None |
| A0A0S4JQ80 | 29-260 | None |
| A0A0S4JR82 | 20-290 | None |
| A0A438DC57 | 202-405 | None |
| A0A819Y268 | 90-356 | None |
| A0A7I4BUL1 | 299-531 | None |
| A0A080WIJ9 | 89-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.