DPCstruct | MC27132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 2.65 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7LSV6 | 144-193 | RELVDTEDKQKPLSDQTISEKMAEAGMQLSRRGVTKYRKNLSIPSSTQRK |
| A0A0K9HIX6 | 1-61 | MKAIIQELIAAEDRQTPLSGQQLADLLHGRYGIAISLRTVAKYREQLRIPSSAKRKQYTGA |
| A0A2G6KAE1 | 698-751 | None |
| A0A7C2H9S9 | 186-236 | None |
| A0A3R8LQR2 | 606-656 | None |
| A0A2K2U7B9 | 120-173 | None |
| A0A220VC34 | 24-75 | None |
| A0A1Y4IDE2 | 18-69 | None |
| A0A7V3VA94 | 186-236 | None |
| A0A1W9WRJ5 | 139-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.