DPCstruct | MC2713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 189 ± 30 aa |
| Standard deviation of domain lengths | 29.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2GKX2 | 1-186 | MNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLTKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKELERRREDSVHQNKDV… |
| V9IKY2 | 1-158 | MNHEWIGNVWLPSLGLPQYRSTFMECLVDARMLDHLTKKDLRGQLRMVDSFHRTSLQYGISCLKRLNYDRQQLEERRRMAEGANVDV… |
| A0A1I8F2F6 | 208-347 | None |
| A0A813SMY2 | 583-775 | None |
| H2ZV17 | 480-675 | None |
| A0A5E4BCQ0 | 269-458 | None |
| A0A3P7EL43 | 1-143 | None |
| A0A6P3Y0E3 | 1073-1257 | None |
| A0A669EQJ3 | 274-524 | None |
| T1GHV3 | 210-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.