DPCstruct | MC27123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Standard deviation of domain lengths | 20.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 88.60 |
| Assigned Pfam label(s) | CL0010- PF04981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2CC88 | 164-279 | AHKKTFYYLEQLILKHKLHSNALNIKEIHDGIDFYYGLKQHAQKMVDFLQCTVPCRSKTSQRLISHDIHSNTYNYKSTFSVEIVPVC… |
| A0A1J5T6R0 | 64-173 | QVCENCSRQAGGYFESTLQLRSKRKSVLASAIEKVRNEISSAPPEIFSTMDAPVRGGHDFQLSSTDKARTIARLMINSYGGSIKEAR… |
| C3ZPJ6 | 66-166 | None |
| A0A816RAV9 | 502-649 | None |
| A0A2G3B957 | 107-221 | None |
| A0A803Q3I8 | 2-103 | None |
| A0A2I1DUE2 | 149-294 | None |
| A0A6B2CD18 | 76-170 | None |
| A0A2R4ZMR4 | 79-217 | None |
| A0A7C1BHM2 | 108-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.