DPCstruct | MC27122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 200 ± 35 aa |
| Standard deviation of domain lengths | 35.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2C0G8 | 8-187 | RLITLKPLKLNIKEPYIPDKNSEKTPEWQKTARYDSKLYGRYGSASGISPESLWPSHKQLESIIAEENEWHPPLEEMLKNIEAREKE… |
| A0A1W4XIB3 | 33-193 | KRNKSQLNPQHHNILFNRRLYNQSIEDFHDTIKYKRKLLSRYGIKSLDIPAGALWLTEEGIEDKMEYERAYNPHTLQEGWKILEEKR… |
| A0A2G9USB2 | 21-220 | None |
| A0A183W179 | 20-243 | None |
| A0A3B3XHM8 | 20-179 | None |
| A0A1D2N747 | 104-330 | None |
| A0A1I8N3P7 | 23-238 | None |
| A0A2G9SHF0 | 6-220 | None |
| A0A8B6C9Q6 | 35-244 | None |
| A0A833RPC8 | 32-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.