DPCstruct | MC27120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 15.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BUG1 | 1-137 | MKMPKPRMTMMGSQAGGPLGHFPPNLRQDLNYPPGSVECTMPNLNPRRKLNSKDTGTPEAWRVMMSLKSGLLAESTWALDTINILLY… |
| A7T009 | 1-124 | MKREVGFPADCVEGTRPVFTKKRKLTSRDLGPVEAWRVMMSLKSGLLAETTWALDTLNILLYDENTVGYFVLSHLPGLLDNLLDHFR… |
| A0A820IDK6 | 1-138 | None |
| B4DYC0 | 86-258 | None |
| A0A6I9PHZ5 | 280-454 | None |
| A0A183HB82 | 282-435 | None |
| A0A3B4DTU9 | 530-686 | None |
| H2ZG59 | 1-142 | None |
| A0A183EJQ0 | 164-317 | None |
| Q8NFD5 | 1565-1737 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.