DPCstruct | MC2712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 500 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 98.90 |
| Assigned Pfam label(s) | PF03381- PF02161- PF02159- PF00104- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8EGX4 | 28-104 | SGKSKDLCVVCGDIASGNHYKVLTCEGCKSFFRRSIQKKAKYHCVRSGNCPITAKDRNKCQKCRLDKCLQMGMDVNS |
| A0A3Q2EHE3 | 6-104 | KAQTKLSVMDVEELCPVCGDKVSGYHYGVLTCESCKGFFKRTVQNKKAYVCVGKQQCQIDQSQRKRCPFCRFQKCLNAGMRLEGKLD… |
| A0A7R9KDQ1 | 141-248 | None |
| A0A7R9KEI7 | 235-320 | None |
| A0A7R9KHR3 | 160-261 | None |
| A0A7R9KKQ9 | 3-94 | None |
| A0A7R9KKT7 | 4-101 | None |
| A0A7R9KT34 | 64-182 | None |
| A0A7R9KN42 | 17-87 | None |
| A0A7R9KQR0 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.