DPCstruct | MC27117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 382 |
|---|---|
| Mean domain length (aa) | 218 ± 39 aa |
| Standard deviation of domain lengths | 38.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.53 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF04233- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0SCS4 | 7-261 | EITATGQTPVGFERVFGKKVQVFGLTVFATRSTSDSKLLHAANVLAQYLDNDADGIADNKLVLKSLQKERGAVVMFASQREAMGIDI… |
| A0A2E6TWK0 | 18-253 | AKVSPPPPKLVKAWKLDPFYTKHLSVNGFPIIASKNVSDHALREAAYLIRNMLGQRKDLLRALVKNKVRFSIIAHNEYTTDIPEHRR… |
| A0A7M5WW47 | 32-307 | None |
| A0A7S4PPH9 | 197-440 | None |
| A0A1H4ATI9 | 712-929 | None |
| A0A399F1A4 | 127-301 | None |
| A0A417DGU9 | 43-234 | None |
| A0A317ZK33 | 543-750 | None |
| A0A1F6PQQ9 | 66-258 | None |
| A0A381R3M2 | 134-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.