DPCstruct | MC27115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 56.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3R7J7 | 19-174 | AVILQRMSSRSFNIYFINQLLLKLSNKYPNRHFVNKIAVLNYMAKALANELLTTEQANSGNFRFNDVGRFKEQYLANIESGTDRSMK… |
| C4YVV6 | 2-160 | AIYLQLKSNREFNLDSINQLLLKLAEKYSNHHFGHKKVLLDYMAKALFHELSDEYTQANHYATKSQFSNFNKAQEQYLDKIESSRNN… |
| A0A4Q3DH56 | 7-198 | None |
| A0A2B4R183 | 274-459 | None |
| B3CUZ3 | 132-293 | None |
| A0A2U3RPD0 | 120-291 | None |
| A0A0F3MJ76 | 13-144 | None |
| A0A2U3QSE9 | 1-132 | None |
| A0A0F3RNM5 | 71-210 | None |
| A0A0F3RI28 | 59-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.