DPCstruct | MC2711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 178 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6P0N2 | 283-465 | DPIFVLKIVVIHVTVVEARRSGLFGLVGDEQIQLVDPWDSNLIMDYFHLTRGSFHEQGQDTVAFFDGFRDNVGRWDLQVGAWVRDGL… |
| A0A169YEG8 | 75-248 | MDIDVAIVIIYIHATRADVLASQLFGLIADEPSQLVDYDDAATISKFRTLLDKNSNNQKRVALAKTFDAIQSSEFPAHVAGWLVKVT… |
| A0A179IJV9 | 198-375 | None |
| A0A2H4S709 | 612-779 | None |
| A0A545V9V5 | 1-205 | None |
| A0A2T5M561 | 69-249 | None |
| A0A094FK15 | 18-211 | None |
| A0A094GA83 | 790-966 | None |
| A0A0A1TPM0 | 210-392 | None |
| A0A229Y9T2 | 588-744 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.