DPCstruct | MC27106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 54.76 |
| Assigned Pfam label(s) | PF00057- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IWG9 | 28-164 | KSATRRALYWLSQQRHDDWGWGGDTARAILTFVLIDSSWFNRQNLESQLATKQMELEIVLQLWRHHELPITSASLAHYSLALNAICQ… |
| E2A3V7 | 1-173 | MFSLIALAGNVEMTFADVEAETILERAATWLWSQRDKDAGWGNDTHRVLLVLRLANLSRDDNVTPSAPPLELQLTAKQMELEIVLLL… |
| A0A4Y2MZY9 | 166-324 | None |
| A0A4Y2PLS2 | 62-225 | None |
| A0A4Y2PFD7 | 5-172 | None |
| A0A182J9V5 | 66-257 | None |
| A0A8B6BJ11 | 78-228 | None |
| A0A4Y2UDZ0 | 185-370 | None |
| A0A4Y2AC50 | 204-349 | None |
| A0A2J7QUQ2 | 6-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.