DPCstruct | MC27104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 377 ± 73 aa |
| Standard deviation of domain lengths | 72.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YGU7 | 77-445 | EERIKKEFERRMQPKTKEDFDLLYAALEKWRLEELGHIDVELEGPERKAALCALLEQETQLIASIGRHELSAAKNNKEKRIQNFLDK… |
| E1ZUX0 | 11-372 | PRTRSDFESLYNLLDRWRILEIERANSTLVESSRIAACGLILSKEIELLRAIDSKKTAVWLKCKEQKRRKLLDELSRPVVWQDSRGQ… |
| A0A0X3Q1P3 | 204-721 | None |
| A0A7R9IY89 | 437-875 | None |
| S9WQA7 | 113-378 | None |
| A0A1X7T298 | 227-519 | None |
| A0A3Q1G8Y6 | 314-692 | None |
| A0A3Q4HB78 | 202-573 | None |
| A0A834XNF3 | 498-1009 | None |
| A0A1X7T844 | 3-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.