DPCstruct | MC27100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 194 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 67.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2T188 | 44-262 | VSYVLEKGMDHSEEFLELLTKRAGESSLTHVKRLCPCSGFVSNSCNCYGNFVPQCTCMRPFVPQSHCACAAWAETAQCRASCQHACL… |
| A0A016WMC2 | 1-184 | MHTVHALGLVLLAALTEQHLLGSCPCAQLPANFCSCNAGLSPLCSCRAIIPSVSCSCALRAQVSHCQSSCLQTCQSTCALNTLSLSC… |
| Q19182 | 1-213 | None |
| W2T358 | 1-189 | None |
| A0A368FBV6 | 1-193 | None |
| A0A158P915 | 51-241 | None |
| A0A0C2FFM0 | 1-181 | None |
| W2TTM9 | 7-203 | None |
| A0A0N4WSG0 | 2-180 | None |
| A0A016WL01 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.