DPCstruct | MC2710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20246 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167VG30 | 19-148 | YKQDGEHKCSKPPFSVRLLEQNAVAGQGERDQLLALLPALYRKESGDMAAASQHVTACVEEGLNLERLASIHGWLWIAGLPFPPRAL… |
| A0A395T9Q4 | 20-127 | PFSPESSVVSAKSCIENLPASVVAREQSIRPARNLNLFLLTDLETWKIDRIYSHLWFAGGRLLRARSLHRYSVSRRQVVITENPSEH… |
| A0A6S6VG65 | 10-124 | None |
| E5A0S7 | 107-261 | None |
| A0A179HGM1 | 4-140 | None |
| A0A2U3DR53 | 9-136 | None |
| A0A370PLW5 | 6-135 | None |
| A0A3N4K9G3 | 6-149 | None |
| A0A3D8SZ38 | 5-119 | None |
| A0A178F1T7 | 924-1064 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.