DPCstruct | MC271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 763 |
|---|---|
| Mean domain length (aa) | 159 ± 28 aa |
| Standard deviation of domain lengths | 27.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 99.59 |
| Assigned Pfam label(s) | CL0001- PF02469- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5MUL4 | 65-286 | LTVQRIYNQGNGKSYILNDEPMMTTRNAVYDILQKPEFSEFFKLLNGTGLLTNLQNNHANASQNNISFLSKFHYTVYVPTNASILAL… |
| A0A645GT46 | 3-145 | DIALSNENFSILVAALQKAELVDTLKGDGPFTVFAPTNKAFEDLLAALNISSSDLLAQPDLAKVLLYHVVSGQVLSTDLTNGMEAAT… |
| A0A1B0BG69 | 559-750 | None |
| A0A5S6QFC5 | 258-406 | None |
| A0A179I6C9 | 548-772 | None |
| C3ZJM7 | 38-193 | None |
| A0A355IR16 | 55-197 | None |
| A0A5N5TE96 | 221-373 | None |
| A0A7R9Q2A1 | 4-141 | None |
| A0A7S4A1K4 | 185-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.