DPCstruct | MC27092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016W900 | 1-88 | MQEADIKFRILASGVLEILNKYKRRRYCNMTREQWERFRQLREMTDDGSIRVTVSDKGGEFVIIPQALDREITDLHLSDATIYRQTVY |
| A0A0C2DAE9 | 94-182 | NASVDVSFRLFADEVYKTLARQKQRRISSNLSLAQKEGIKQVRELVESAEIRLSTSDKGGEFVVIPHQLDVAITERHLQDASLYRPS… |
| A0A016W3S2 | 22-109 | None |
| A0A016U4Q8 | 1-88 | None |
| A0A158PJU8 | 175-262 | None |
| A0A016WIL4 | 71-158 | None |
| A0A016W7A8 | 3-103 | None |
| A0A016UC74 | 263-350 | None |
| A0A016X173 | 11-106 | None |
| A0A7I4Z2J2 | 158-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.