DPCstruct | MC27091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 79 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822INE7 | 3-87 | MFTNQGTVIHFNNPKVQASLAANTFPVTGHTEWLTEMLPGILNQHAADSLTSLRRLTEALPEKSVDGEEEEGEVPDLVENFDEAN |
| A0A485PTV0 | 28-90 | RFTNQGTVIHFNKPKVNASLAANTLTILGHAERKWLTEMLPGILNQLGADSLTSLRRLAEALP |
| A0A2Y9G4P8 | 1-90 | None |
| A0A0E0J4U8 | 457-554 | None |
| I3NBT6 | 48-126 | None |
| A0A7I2YQL2 | 64-129 | None |
| A0A177TV16 | 111-204 | None |
| M4DJA1 | 231-331 | None |
| A0A5N4DKB1 | 45-123 | None |
| A0A7J7IFS6 | 80-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.