DPCstruct | MC27088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 148 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142JKF5 | 1-165 | MSYDQGPQPILRCVRKIGEKWFEKAAFYKNTNPNSRAAFSGYIDLVGQGRQHVFGFINPRRDGEGVVISLTASYIDPTSGEMGRRTV… |
| A0A1I0LM74 | 1-172 | MSTAGVAEKVKPVLRAVVQRGEKWFETAVFVPSSKPDSKAVLTGHIDLGLGDGRIPVFAFVNERKDGAPTGAKYISLTTRKVHPRTG… |
| A0A2K4X3P4 | 477-611 | None |
| A0A522FGH6 | 202-365 | None |
| A0A455VG88 | 730-869 | None |
| B7UEZ2 | 1043-1178 | None |
| A0A6M4P488 | 315-426 | None |
| A0A3M3J906 | 526-678 | None |
| A0A5D3J7N4 | 65-232 | None |
| A0A1B7HGB4 | 883-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.