DPCstruct | MC27087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 182 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1FHC6 | 1-192 | MVVTSGGNGPCRAGHYGELSERIMRSIGKDIEVIVFDSIYQKPIDFIKKVNRVNSARLSPLSIIQLVRFYWRKLQALDNLERLSHKV… |
| A0A1C6HMQ6 | 98-285 | MITQTGGGCRASNYIHLLRKALKKAGFENVPVISLNVSGLEKNSGFSLTVPMIRKALAGLVYGDALMLFNNQTKAYEINKGESDALV… |
| A0A1V4XIX8 | 1-170 | None |
| A0A2N9M183 | 95-274 | None |
| A0A661M9B5 | 134-306 | None |
| A0A1W1USC1 | 170-364 | None |
| A0A847FAG4 | 130-296 | None |
| A0A0F2IW88 | 351-525 | None |
| X1F644 | 1-190 | None |
| A0A7C1F7C8 | 29-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.