DPCstruct | MC27084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 24.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090S525 | 2-142 | LGFYIRKLFWLLTPKPILRAYKSYLEQKLVDKKNYIESRVNYYCQLNQAFEIPSLDATTYGSYKRRGNTSYYYDLKEYLRYFPSTCK… |
| A0A527FTP5 | 2-105 | VRDRVNYYNRLDHSFVPSAAAVPASQIPKFGSMYYYDLKEFARYFDRHLLIDLEFGDVVDVPAVPSIVKDRPIRNDNGNAVIMKLDK… |
| A0A377JM90 | 1-140 | None |
| A0A5J4PJQ2 | 1-184 | None |
| A0A1M7HCT8 | 12-177 | None |
| A0A239R3L1 | 301-494 | None |
| A0A381CJQ3 | 9-166 | None |
| A0A7J6ZCZ5 | 217-369 | None |
| W7Y1H5 | 18-162 | None |
| A0A1Z5HG96 | 16-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.